Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30), Biotinylated

This Recombinant Human T cell receptor beta variable 30 (TVB30), Biotinylated spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mvk Pre-designed siRNA Set B
SI208869B 1 Each

Rat Mvk Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Oenothera villaricae Protein ycf2 (ycf2), partial
MBS1046634 Inquire

Recombinant Oenothera villaricae Protein ycf2 (ycf2), partial

Sign In for Pricing
View Details
Alectinib (CH5424802)
MBS576923 Inquire

Alectinib (CH5424802)

Sign In for Pricing
View Details
Cilp2 (NM_001107307) Rat Tagged ORF Clone
RR208414 10 µg

Cilp2 (NM_001107307) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Thromboxane B2,TXB2 ELISA Kit
CN-02802M1 96T

Mouse Thromboxane B2,TXB2 ELISA Kit

Sign In for Pricing
View Details
Abcc1 (NM_008576) Mouse Untagged Clone
MC224639 10 µg

Abcc1 (NM_008576) Mouse Untagged Clone

Sign In for Pricing
View Details