Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30), Biotinylated

This Recombinant Human T cell receptor beta variable 30 (TVB30), Biotinylated spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amphotericin B methyl ester hydrochloride
T74061-01 5 mg

Amphotericin B methyl ester hydrochloride

Sign In for Pricing
View Details
Amphotericin B methyl ester hydrochloride
T74061-02 50 mg

Amphotericin B methyl ester hydrochloride

Sign In for Pricing
View Details
CometAssay 96 Well ES Starter Kit
4253-096-ESK 1 Kit

CometAssay 96 Well ES Starter Kit

Sign In for Pricing
View Details
MID2 Antibody - C-terminal region (ARP57854_P050)
ARP57854_P050 100 µL

MID2 Antibody - C-terminal region (ARP57854_P050)

Sign In for Pricing
View Details
[IHC]CD117 Rabbit Monoclonal Antibody, 1 pack = 100 µL
BAL3281 1 Each

[IHC]CD117 Rabbit Monoclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Carboxypeptidase B1, Tissue (CPB1)
MBS2076229-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Carboxypeptidase B1, Tissue (CPB1)

Sign In for Pricing
View Details