Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated

This Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-1-(4-chlorophenyl)ethanone
TRC-C368618-50MG 50 mg

2-Chloro-1-(4-chlorophenyl)ethanone

Sign In for Pricing
View Details
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF640R conjugate, 0.1mg/mL
BNC402983-100 1x 100 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2979R), CF405S conjugate, 0.1mg/mL
BNC042979-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2979R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bisnorcholenaldehyde
TRC-B508830-25MG 25 mg

Bisnorcholenaldehyde

Sign In for Pricing
View Details
H3.3B (H3F3B) Human Gene Knockout Kit (CRISPR)
KN202257LP 1 Kit

H3.3B (H3F3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF640R conjugate, 0.1mg/mL
BNC403185-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details