Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated

This Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgp9.5 (UCHL-1) (31A3), CF647 conjugate, 0.1mg/mL
BNC470046-500 1x 500 µL

Pgp9.5 (UCHL-1) (31A3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF740 conjugate, 0.1mg/mL
BNC742266-100 1x 100 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3306), 0.2mg/mL
BNUB3306-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3306), 0.2mg/mL

Sign In for Pricing
View Details
Carfilzomib
SIH-544-25MG 25 mg

Carfilzomib

Sign In for Pricing
View Details
MAPKAP Kinase 2 (MAPKAPK2) Goat Polyclonal Antibody
AP32810PU-N 100 µg

MAPKAP Kinase 2 (MAPKAPK2) Goat Polyclonal Antibody

Sign In for Pricing
View Details
UBE3B Human Gene Knockout Kit (CRISPR)
KN419024 1 Kit

UBE3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details