Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated

This Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Breast
CB539382 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
OptiClear Sample Kit II
OE-109 1 L

OptiClear Sample Kit II

Sign In for Pricing
View Details
Recombinant Human VSIG8 Protein (Fc Tag)
PKSH033221-01 10 µg

Recombinant Human VSIG8 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human VSIG8 Protein (Fc Tag)
PKSH033221-02 50 µg

Recombinant Human VSIG8 Protein (Fc Tag)

Sign In for Pricing
View Details
CDK2 Mouse Monoclonal Antibody [Clone ID: 4i33]
AM08409PU-N 50 µg

CDK2 Mouse Monoclonal Antibody [Clone ID: 4i33]

Sign In for Pricing
View Details
Gephyrin (GPHN) (NM_020806) Human Over-expression Lysate
LC402806 20 µg

Gephyrin (GPHN) (NM_020806) Human Over-expression Lysate

Sign In for Pricing
View Details