Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated

This Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Rabbit Anti-PHA-E Antibody
AAL-1802-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Anti-PHA-E Antibody

Sign In for Pricing
View Details
LINC02693 (NM_001113434) Human Over-expression Lysate
LY426413 100 µg

LINC02693 (NM_001113434) Human Over-expression Lysate

Sign In for Pricing
View Details
CPSF30 (CPSF4) (NM_006693) Human Over-expression Lysate
LC429309 20 µg

CPSF30 (CPSF4) (NM_006693) Human Over-expression Lysate

Sign In for Pricing
View Details
C8 (C8G) Human Gene Knockout Kit (CRISPR)
KN422236 1 Kit

C8 (C8G) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P53 (Tumor Suppressor Protein) (TP53/2719), CF405S conjugate, 0.1mg/mL
BNC042719-100 1x 100 µL

P53 (Tumor Suppressor Protein) (TP53/2719), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LSP1 Rabbit Polyclonal Antibody
TA361271 100 µL

LSP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details