Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated

This Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF640R conjugate, 0.1mg/mL
BNC402430-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 690 succinimidyl ester
1042-AAT 1 mg

IFluor® 690 succinimidyl ester

Sign In for Pricing
View Details
Human RNF87 (TRIM4) activation kit by CRISPRa
GA113921 1 Kit

Human RNF87 (TRIM4) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS633573 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
10-Undecen-1-ol
TRC-U788843-50G 50 g

10-Undecen-1-ol

Sign In for Pricing
View Details
GranULin (GRN) Human Gene Knockout Kit (CRISPR)
KN202139LP 1 Kit

GranULin (GRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details