Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated

This Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB4 AAV siRNA Pooled Vector
23580161 1.0 µg

HMGB4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Ac-D-Pro-OH
5-03357 5 g

Ac-D-Pro-OH

Sign In for Pricing
View Details
ARK5 (A-9) : m-IgG Fc BP-HRP Bundle
sc-527296 1 Kit

ARK5 (A-9) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Whatman PTFE membrane circles 1 um 47mm
FIL3114 100 / PCK

Whatman PTFE membrane circles 1 um 47mm

Sign In for Pricing
View Details
PCDHA4 sgRNA CRISPR Lentivector (Human) (Target 3)
K1603804 1.0 µg DNA

PCDHA4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rat Anti-Mouse Kappa (kappa chain)-HRP Conjugate Antibody
MBS4152267-01 0.1 mL

Rat Anti-Mouse Kappa (kappa chain)-HRP Conjugate Antibody

Sign In for Pricing
View Details