Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated

This Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIR2DL4 Mouse Monoclonal Antibody [Clone ID: mAb#33]
AM26033AC-N 100 Tests

KIR2DL4 Mouse Monoclonal Antibody [Clone ID: mAb#33]

Sign In for Pricing
View Details
Recombinant Rift Valley fever virus (TAN/Dod-002/07) RVFV-L Protein (His Tag)
PKSV030247 100 µg

Recombinant Rift Valley fever virus (TAN/Dod-002/07) RVFV-L Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709483 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tribromoneopentanol
TRC-T772640-250G 250 g

Tribromoneopentanol

Sign In for Pricing
View Details
Human ZNF730 activation kit by CRISPRa
GA119102 1 Kit

Human ZNF730 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant STIP1/STI1 Monoclonal Antibody
AN301667L-01 50 µL

Recombinant STIP1/STI1 Monoclonal Antibody

Sign In for Pricing
View Details