Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated

This Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 Recombinant Mouse Monoclonal Antibody [A4B3-R]
HA601260 100 µL

Cytokeratin 18 Recombinant Mouse Monoclonal Antibody [A4B3-R]

Sign In for Pricing
View Details
HEATR4 (NM_203309) Human Over-expression Lysate
LC404391 20 µg

HEATR4 (NM_203309) Human Over-expression Lysate

Sign In for Pricing
View Details
2,4-Dichlorophenol-13C6
TRC-D435686-25MG 25 mg

2,4-Dichlorophenol-13C6

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Bromo PEG
125000-1.1G 1 g

Ɑ-Methoxy-ω-Bromo PEG

Sign In for Pricing
View Details
Amplite® Fluorimetric Hypochlorite (Hypochlorous Acid) Assay Kit
13846-AAT 200 Tests

Amplite® Fluorimetric Hypochlorite (Hypochlorous Acid) Assay Kit

Sign In for Pricing
View Details
Recombinant CTCFL Monoclonal Antibody
AN302061L-01 50 µL

Recombinant CTCFL Monoclonal Antibody

Sign In for Pricing
View Details