Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated

This Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NHLRC3 activation kit by CRISPRa
GA117923 1 Kit

Human NHLRC3 activation kit by CRISPRa

Sign In for Pricing
View Details
Texas Red Conjugated Rabbit Polyclonal Antibody to Guinea Pig IgG
TA-2358-2 2 mL

Texas Red Conjugated Rabbit Polyclonal Antibody to Guinea Pig IgG

Sign In for Pricing
View Details
RSK3 (RPS6KA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F11]
TA809900BM 100 µL

RSK3 (RPS6KA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F11]

Sign In for Pricing
View Details
Saliva/Swab RNA Purification 96-Well Kit Dx
Dx69300 2 Plates

Saliva/Swab RNA Purification 96-Well Kit Dx

Sign In for Pricing
View Details
Secnidazole Formate
TRC-S225005-10MG 10 mg

Secnidazole Formate

Sign In for Pricing
View Details
Frozen Tissue Sections, Appendix
CS620340 5x 5 µm

Frozen Tissue Sections, Appendix

Sign In for Pricing
View Details