Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated

This Recombinant Human T cell receptor beta variable 6-4 (TVB64), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4K5 Rabbit Polyclonal Antibody (Fluoro550)
orb3096624 100 µg

MAP4K5 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
MTHSP1 AAV siRNA Pooled Vector
30894161 1.0 µg

MTHSP1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Sppl2b Mouse shRNA Plasmid (Locus ID 73218)
TR515217 1 Kit

Sppl2b Mouse shRNA Plasmid (Locus ID 73218)

Sign In for Pricing
View Details
NALP2/NLRP2 Rabbit Polyclonal Antibody (Fluoro594)
orb3104895 100 µg

NALP2/NLRP2 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
2-(Triphenylphosphoranylidene)-butanedioic Acid 1,4-Diethyl Ester-13C4
TRC-T808987-2.5MG 2.5 mg

2-(Triphenylphosphoranylidene)-butanedioic Acid 1,4-Diethyl Ester-13C4

Sign In for Pricing
View Details
Vmn1r82 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4036108 1.0 µg DNA

Vmn1r82 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details