Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated

This Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coelenterazine N
#10115 1x 50 µg

Coelenterazine N

Sign In for Pricing
View Details
Human APOB48R (APOBR) activation kit by CRISPRa
GA111057 1 Kit

Human APOB48R (APOBR) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Sarcomeric alpha Actinin Antibody
RC-15983-01 50 μL

Recombinant Sarcomeric alpha Actinin Antibody

Sign In for Pricing
View Details
Recombinant Sarcomeric alpha Actinin Antibody
RC-15983-02 100 µL

Recombinant Sarcomeric alpha Actinin Antibody

Sign In for Pricing
View Details
Recombinant Sarcomeric alpha Actinin Antibody
RC-15983-03 1 mL

Recombinant Sarcomeric alpha Actinin Antibody

Sign In for Pricing
View Details
MAGic Clamp™ Tube Rack, 15x50ml, tubes (max. 2)
H1000-MR-T50 1 Each

MAGic Clamp™ Tube Rack, 15x50ml, tubes (max. 2)

Sign In for Pricing
View Details