Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated

This Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lymphoid tissue
CS620317 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Squaric Acid Ester Amido PEG
135000-00-50.500MG 500 mg

Ɑ-Hydroxy-ω-Squaric Acid Ester Amido PEG

Sign In for Pricing
View Details
PEF1 (NM_012392) Human Over-expression Lysate
LY402204 100 µg

PEF1 (NM_012392) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/1783R), CF647 conjugate, 0.1mg/mL
BNC471783-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/1783R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acryloylglycine
TRC-A191390-250MG 250 mg

Acryloylglycine

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF568 conjugate, 0.1mg/mL
BNC681633-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details