Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated

This Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vimentin (VIM) Rabbit Monoclonal Antibody [Clone ID: R02-8C4]
TA385551 100 µL

Vimentin (VIM) Rabbit Monoclonal Antibody [Clone ID: R02-8C4]

Sign In for Pricing
View Details
Neurofilament H (200 kD) Mouse Monoclonal Antibody [Clone ID: NF-05]
AM26036PU-N 100 µg

Neurofilament H (200 kD) Mouse Monoclonal Antibody [Clone ID: NF-05]

Sign In for Pricing
View Details
Chmp6 Mouse Gene Knockout Kit (CRISPR)
KN503283 1 Kit

Chmp6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human ILT6/LILRA3 Protein (Fc Tag)
PKSH030602 100 µg

Recombinant Human ILT6/LILRA3 Protein (Fc Tag)

Sign In for Pricing
View Details
Psma6 Mouse Gene Knockout Kit (CRISPR)
KN514094 1 Kit

Psma6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,2,3-O-Tris(triisopropyl) Glycerol-d5
TRC-T886402-10MG 10 mg

1,2,3-O-Tris(triisopropyl) Glycerol-d5

Sign In for Pricing
View Details