Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated

This Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF647 conjugate, 0.1mg/mL
BNC471880-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NCOA4 Recombinant Rabbit monoclonal Antibody
HA751004 100 µL

NCOA4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS636976 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
GRIA1 Rabbit Polyclonal Antibody
AP20752PU-N 100 µg

GRIA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Interleukin 13 (IL13) ELISA Kit
RDR-IL13-p-01 96 Tests

Porcine Interleukin 13 (IL13) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 13 (IL13) ELISA Kit
RDR-IL13-p-02 48 Tests

Porcine Interleukin 13 (IL13) ELISA Kit

Sign In for Pricing
View Details