Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated

This Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Hydroxy-2-oxo-2H-chromene-3-carbaldehyde
OR73527-01 100 mg

7-Hydroxy-2-oxo-2H-chromene-3-carbaldehyde

Sign In for Pricing
View Details
7-Hydroxy-2-oxo-2H-chromene-3-carbaldehyde
OR73527-02 250 mg

7-Hydroxy-2-oxo-2H-chromene-3-carbaldehyde

Sign In for Pricing
View Details
7-Hydroxy-2-oxo-2H-chromene-3-carbaldehyde
OR73527-03 1 g

7-Hydroxy-2-oxo-2H-chromene-3-carbaldehyde

Sign In for Pricing
View Details
MICAL C-terminal-Like protein (MICALCL) Human ELISA Kit
E9883 96 Tests

MICAL C-terminal-Like protein (MICALCL) Human ELISA Kit

Sign In for Pricing
View Details
CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (HRP)
MBS6374933-01 0.1 mL

CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (HRP)

Sign In for Pricing
View Details
CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (HRP)
MBS6374933-02 5x 0.1 mL

CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (HRP)

Sign In for Pricing
View Details