Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2), Biotinylated

This Recombinant Human T cell receptor beta variable 2 (TVB2), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Rectum
CD563568 5 µg

Tissue Genomic DNA, Rectum

Sign In for Pricing
View Details
BLBP (FABP7) Mouse Monoclonal Antibody [Clone ID: AT1D1]
AM09059PU-N 100 µL

BLBP (FABP7) Mouse Monoclonal Antibody [Clone ID: AT1D1]

Sign In for Pricing
View Details
Mouse Aox1 activation kit by CRISPRa
GA200202 1 Kit

Mouse Aox1 activation kit by CRISPRa

Sign In for Pricing
View Details
Chrna7 Mouse Gene Knockout Kit (CRISPR)
KN303310RB 1 Kit

Chrna7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant GCLM Antibody
RC-15696-01 50 μL

Recombinant GCLM Antibody

Sign In for Pricing
View Details
Recombinant GCLM Antibody
RC-15696-02 100 µL

Recombinant GCLM Antibody

Sign In for Pricing
View Details