Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated

This Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Stem Cell Factor (SCF) ELISA Kit
DLR-SCF-Ra-96T 96 Tests

Rat Stem Cell Factor (SCF) ELISA Kit

Sign In for Pricing
View Details
Human DEFB4B siRNA
abx913957-01 15 nmol

Human DEFB4B siRNA

Sign In for Pricing
View Details
Human DEFB4B siRNA
abx913957-02 30 nmol

Human DEFB4B siRNA

Sign In for Pricing
View Details
Lunatoic acid B
orb3023206-01 50 mg

Lunatoic acid B

Sign In for Pricing
View Details
Lunatoic acid B
orb3023206-02 10 mg

Lunatoic acid B

Sign In for Pricing
View Details
Krtap13-1 (NM_183189) Mouse Tagged ORF Clone
MR201382 10 µg

Krtap13-1 (NM_183189) Mouse Tagged ORF Clone

Sign In for Pricing
View Details