Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated

This Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRIPT Reverse Transcriptase
orb1821425 1 Mio Units

SCRIPT Reverse Transcriptase

Sign In for Pricing
View Details
Glucosamine-FITC
orb3134748-01 10 mg

Glucosamine-FITC

Sign In for Pricing
View Details
Glucosamine-FITC
orb3134748-02 50 mg

Glucosamine-FITC

Sign In for Pricing
View Details
ANKFN1 HDR Plasmid (m)
sc-436396-HDR 20 µg

ANKFN1 HDR Plasmid (m)

Sign In for Pricing
View Details
Human Herpes simplexvirus (HSV) ELISA Kit
QY-E03932 96 Tests

Human Herpes simplexvirus (HSV) ELISA Kit

Sign In for Pricing
View Details
CXCL3 Adenovirus (Rat)
17176056 1.0 mL

CXCL3 Adenovirus (Rat)

Sign In for Pricing
View Details