Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated

This Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CREG1 antibody
STJ192205 200 µl

Anti-CREG1 antibody

Sign In for Pricing
View Details
ASS1 Mouse Monoclonal Antibody [Clone:8C4]
E45M18793 100 µg

ASS1 Mouse Monoclonal Antibody [Clone:8C4]

Sign In for Pricing
View Details
Anti-SERPINB13 Antibody (56313) - 100 μg
56313-100μg 100 µg

Anti-SERPINB13 Antibody (56313) - 100 μg

Sign In for Pricing
View Details
Calpain, Small Subunit 1 (CAPNS1) BioAssayTM ELISA Kit (Mouse)
517059 96 Tests

Calpain, Small Subunit 1 (CAPNS1) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Human Protein tyrosine phosphatase type IVA 1 (PTP4A1) ELISA Kit
KTE61057-01 48 Tests

Human Protein tyrosine phosphatase type IVA 1 (PTP4A1) ELISA Kit

Sign In for Pricing
View Details
Human Protein tyrosine phosphatase type IVA 1 (PTP4A1) ELISA Kit
KTE61057-02 96 Tests

Human Protein tyrosine phosphatase type IVA 1 (PTP4A1) ELISA Kit

Sign In for Pricing
View Details