Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2B type 2-K1 (H2BK1), Biotinylated

This Recombinant Human Histone H2B type 2-K1 (H2BK1), Biotinylated spans the amino acid sequence from region 2-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B type 2-K1; Histone H2B type 2-E1; H2BK1 H2BE1

UniProt

A0A2R8Y619

Expression Region

2-122

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAEYGQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFEQLACEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A COOH
HA50056003.100G 100 g

Polystyrene A COOH

Sign In for Pricing
View Details
2,3-Dichlorophenoxyacetic Acid
TRC-D474153-5G 5 g

2,3-Dichlorophenoxyacetic Acid

Sign In for Pricing
View Details
Serpine1 Mouse Gene Knockout Kit (CRISPR)
KN515604 1 Kit

Serpine1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Valnemulin Trifluoroacetic Acid Salt-d6
TRC-V094402-1MG 1 mg

Valnemulin Trifluoroacetic Acid Salt-d6

Sign In for Pricing
View Details
Band 3/AE 1 Antibody
KC-593-01 50 μL

Band 3/AE 1 Antibody

Sign In for Pricing
View Details
Band 3/AE 1 Antibody
KC-593-02 100 µL

Band 3/AE 1 Antibody

Sign In for Pricing
View Details