Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A-like 3 (H2AL3), Biotinylated

This Recombinant Human Histone H2A-like 3 (H2AL3), Biotinylated spans the amino acid sequence from region 1-148. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2A-like 3; H2A.L.3; H2AL3 H2AL1RP

UniProt

A0A3B3IU63

Expression Region

1-148

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTANILEKVGKEVKNSCRLCITPEHVKRALQKDEQLRWILELEDDTHSQVEEMPQSEEEEEEEEEKEEEMVVLVVMGGRRRRRRRRRRKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHC1P1 Recombinant Protein (Human)
RP083103 100 µg

PHC1P1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Porcine Clathrin interactor 1 (CLINT1) ELISA Kit
MBS7210879-01 48 Well

Porcine Clathrin interactor 1 (CLINT1) ELISA Kit

Sign In for Pricing
View Details
Porcine Clathrin interactor 1 (CLINT1) ELISA Kit
MBS7210879-02 96 Well

Porcine Clathrin interactor 1 (CLINT1) ELISA Kit

Sign In for Pricing
View Details
Porcine Clathrin interactor 1 (CLINT1) ELISA Kit
MBS7210879-03 5x 96 Well

Porcine Clathrin interactor 1 (CLINT1) ELISA Kit

Sign In for Pricing
View Details
Porcine Clathrin interactor 1 (CLINT1) ELISA Kit
MBS7210879-04 10x 96 Well

Porcine Clathrin interactor 1 (CLINT1) ELISA Kit

Sign In for Pricing
View Details
PE-Cy7 Anti-Human CD21 Antibody (HB5)
PC7-30218-01 20 Tests

PE-Cy7 Anti-Human CD21 Antibody (HB5)

Sign In for Pricing
View Details