Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional regulator PINT87aa (PNT87), Biotinylated

This Recombinant Human Transcriptional regulator PINT87aa (PNT87), Biotinylated spans the amino acid sequence from region 1-87. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transcriptional regulator PINT87aa LINC-PINT

UniProt

A0A455ZAR2

Expression Region

1-87

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pdia4 shRNA (UAS) - Lentiviral mouse Pdia4 shRNA (UAS, RFP) (25)
GTR15234419 1 Vial

Lentiviral mouse Pdia4 shRNA (UAS) - Lentiviral mouse Pdia4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
DDB2 Double Nickase Plasmid (m2)
sc-430779-NIC-2 20 µg

DDB2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rotavirus (Group A) Mouse Monoclonal Antibody [Clone ID: 0581]
AM01342PU-N 100 µg

Rotavirus (Group A) Mouse Monoclonal Antibody [Clone ID: 0581]

Sign In for Pricing
View Details
FGF2 Recombinant Protein
OPCD03196-200UG 200 µg

FGF2 Recombinant Protein

Sign In for Pricing
View Details
Phospho-Aconitase 1 (Ser711) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-12958R-BF555 100 µL

Phospho-Aconitase 1 (Ser711) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (PE)
246267-PE 100 µL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (PE)

Sign In for Pricing
View Details