Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated

This Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-2 TRBV4-2 TCRBV7S3A2 TCRBV7S3A2T

UniProt

A0A539

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit
MBS9363072-01 48 Well

Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit

Sign In for Pricing
View Details
Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit
MBS9363072-02 96 Well

Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit

Sign In for Pricing
View Details
Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit
MBS9363072-03 5x 96 Well

Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit

Sign In for Pricing
View Details
Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit
MBS9363072-04 10x 96 Well

Horse Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 (MALT1) ELISA Kit

Sign In for Pricing
View Details
IgG (G1m Marker, G2m Marker, G3m Marker, G4m Marker, HDC, Heavy Chain Disease Protein, Human Immunglobulin G, Ig gamma1/2/3/4 Chain C Region, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Heavy Constant, Immunoglobulin Gamma Heavy Chain) (BSA & Azide Free) (MaxLight 750) discontinued
172111-AF-ML750 100 µL

IgG (G1m Marker, G2m Marker, G3m Marker, G4m Marker, HDC, Heavy Chain Disease Protein, Human Immunglobulin G, Ig gamma1/2/3/4 Chain C Region, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Heavy Constant, Immunoglobulin Gamma Heavy Chain) (BSA & Azide Free) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LOC257650 Rat siRNA Oligo Duplex (Locus ID 257650)
SR506483 1 Kit

LOC257650 Rat siRNA Oligo Duplex (Locus ID 257650)

Sign In for Pricing
View Details