Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 3-1 (TVB31), Biotinylated

This Recombinant Human T cell receptor beta variable 3-1 (TVB31), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 3-1 TRBV3-1 TCRBV9S1A1T

UniProt

A0A576

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVSQTPKYLVTQMGNDKSIKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLNLHINSLELGDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PAPOLA Antibody [Biotin]
NB100-55268B 0.1 mL

Rabbit Polyclonal PAPOLA Antibody [Biotin]

Sign In for Pricing
View Details
LLGL1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
26890156 3x 1.0 µg DNA

LLGL1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
FAM170A Double Nickase Plasmid (h2)
sc-415534-NIC-2 20 µg

FAM170A Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ELISA Kit For Chymotrypsin-like elastase family member 1
E1483r 96 Tests

ELISA Kit For Chymotrypsin-like elastase family member 1

Sign In for Pricing
View Details
Dkk-2 CRISPR Activation Plasmid (m)
sc-425314-ACT 20 µg

Dkk-2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Canine Apolipoprotein F ELISA kit
GTR10414340 96 Well

Canine Apolipoprotein F ELISA kit

Sign In for Pricing
View Details