Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41), Biotinylated

This Recombinant Human T cell receptor beta variable 4-1 (TVB41), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF568 conjugate, 0.1mg/mL
BNC681782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP9 (rMMP9/1769), Biotin conjugate, 0.1mg/mL
BNCB2176-500 1x 500 µL

MMP9 (rMMP9/1769), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dembrexine Hydrochloride
TRC-D532000-10MG 10 mg

Dembrexine Hydrochloride

Sign In for Pricing
View Details
CNR1 Antibody
8G226-AAT 50 µg

CNR1 Antibody

Sign In for Pricing
View Details
Brms1 Mouse Gene Knockout Kit (CRISPR)
KN502271 1 Kit

Brms1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP9 (rMMP9/1769), CF568 conjugate, 0.1mg/mL
BNC682176-500 1x 500 µL

MMP9 (rMMP9/1769), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details