Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41), Biotinylated

This Recombinant Human T cell receptor beta variable 4-1 (TVB41), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LAMTOR2 sgRNA gene knockout kit - Lentiviral human LAMTOR2 sgRNA gene knockout kit (100)
GTR15380893 1 Vial

Lentiviral human LAMTOR2 sgRNA gene knockout kit - Lentiviral human LAMTOR2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
WDR70 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV660472 1.0 µg DNA

WDR70 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
TBC1D5 (NM_001134381) Human Tagged ORF Clone
RC226188 10 µg

TBC1D5 (NM_001134381) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human NECTIN4 Recombinant Protein
PPT-14154 100 µg

Human NECTIN4 Recombinant Protein

Sign In for Pricing
View Details
Anserini Ag-NORs ELISA Kit
EAA0772 96 Tests

Anserini Ag-NORs ELISA Kit

Sign In for Pricing
View Details
SLF1081851 . hydrochloride
ENZ-CHM475-0025 25 mg

SLF1081851 . hydrochloride

Sign In for Pricing
View Details