Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-1 (TVB51), Biotinylated

This Recombinant Human T cell receptor beta variable 5-1 (TVB51), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-1 TRBV5-1 TCRBV5S1A1T

UniProt

A0A578

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-Terf1 Plasmid
PVT38865 2 µg

pExpress-1-Terf1 Plasmid

Sign In for Pricing
View Details
TOE1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2482993 100 µL

TOE1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
OR5AP2 Antibody
OAAF05051-100UG 100 µg

OR5AP2 Antibody

Sign In for Pricing
View Details
B13 Antibody
PHY0520S 150 μg

B13 Antibody

Sign In for Pricing
View Details
PI 3 Kinase Class 3 (PIK3C3) (AK022653) Human Untagged Clone
SC127628 10 µg

PI 3 Kinase Class 3 (PIK3C3) (AK022653) Human Untagged Clone

Sign In for Pricing
View Details
OR1D5 Human Gene Knockout Kit (CRISPR)
KN424882 1 Kit

OR1D5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details