Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]
CF810134 100 µg

MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]

Sign In for Pricing
View Details
CCNQP1 Human Gene Knockout Kit (CRISPR)
KN425327 1 Kit

CCNQP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS700175 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
3,4,5-Trihydroxycinnamic Acid
TRC-T896773-1G 1 g

3,4,5-Trihydroxycinnamic Acid

Sign In for Pricing
View Details
DRP1 Polyclonal Antibody
D-AB-10190L-01 25 µL

DRP1 Polyclonal Antibody

Sign In for Pricing
View Details
DRP1 Polyclonal Antibody
D-AB-10190L-02 100 µL

DRP1 Polyclonal Antibody

Sign In for Pricing
View Details