Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxindole-3-acetic Acid
TRC-O850140-250MG 250 mg

Oxindole-3-acetic Acid

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), 0.2mg/mL
BNUB0788-500 1x 500 µL

MART-1 / Melan-A (MLANA/788), 0.2mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (HMB45), CF568 conjugate, 0.1mg/mL
BNC680444-500 1x 500 µL

Pmel17 / gp100 / SILV (HMB45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS800343 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Uncoated Mouse Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit
E-UNEL-M0198-01 5x 96 Tests

Uncoated Mouse Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit
E-UNEL-M0198-02 15x 96 Tests

Uncoated Mouse Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit

Sign In for Pricing
View Details