Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RALGDS activation kit by CRISPRa
GA104012 1 Kit

Human RALGDS activation kit by CRISPRa

Sign In for Pricing
View Details
PRELP Rabbit Polyclonal Antibody
TA366534 100 µL

PRELP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse FGF basic/FGF2/bFGF, C-His Tag
HA211283-01 20 µg

Mouse FGF basic/FGF2/bFGF, C-His Tag

Sign In for Pricing
View Details
Mouse FGF basic/FGF2/bFGF, C-His Tag
HA211283-02 50 µg

Mouse FGF basic/FGF2/bFGF, C-His Tag

Sign In for Pricing
View Details
Mouse FGF basic/FGF2/bFGF, C-His Tag
HA211283-03 100 µg

Mouse FGF basic/FGF2/bFGF, C-His Tag

Sign In for Pricing
View Details
FOXN2 Antibody
8C10537-AAT 50 µg

FOXN2 Antibody

Sign In for Pricing
View Details