Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43), Biotinylated

This Recombinant Human T cell receptor beta variable 4-3 (TVB43), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB5 (N-term) Rabbit Polyclonal Antibody
AP13085PU-N 400 µL

ABCB5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C10]
TA807139BM 100 µL

GFI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C10]

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), Biotin conjugate, 0.1mg/mL
BNCB2884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NME2 (NM_002512) Human Recombinant Protein
TP761637 50 µg

NME2 (NM_002512) Human Recombinant Protein

Sign In for Pricing
View Details
Synapsin I (SYN1) Rabbit Polyclonal Antibody
AP20761PU-N 100 µg

Synapsin I (SYN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-x (BX006), CF405S conjugate, 0.1mg/mL
BNC040006-500 1x 500 µL

Bcl-x (BX006), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details