Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43), Biotinylated

This Recombinant Human T cell receptor beta variable 4-3 (TVB43), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Geminin (GMNN) activation kit by CRISPRa
GA109522 1 Kit

Human Geminin (GMNN) activation kit by CRISPRa

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Haptoglobin
AA-2121-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Haptoglobin

Sign In for Pricing
View Details
MAD4 (MXD4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]
CF808855 100 µg

MAD4 (MXD4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]

Sign In for Pricing
View Details
Pigh (BC086806) Mouse Tagged ORF Clone
MG201770 10 µg

Pigh (BC086806) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF640R conjugate, 0.1mg/mL
BNC402324-500 1x 500 µL

Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Hydantoin-5-propionic Acid
TRC-H675005-1G 1 g

L-Hydantoin-5-propionic Acid

Sign In for Pricing
View Details