Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43), Biotinylated

This Recombinant Human T cell receptor beta variable 4-3 (TVB43), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Histidine
TRC-H456015-25G 25 g

D-Histidine

Sign In for Pricing
View Details
Pigment Red 23 (tech grade)
TRC-P437790-250MG 250 mg

Pigment Red 23 (tech grade)

Sign In for Pricing
View Details
ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF594 conjugate, 0.1mg/mL
BNC941282-500 1x 500 µL

ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Morg1 (WDR83) (NM_001099737) Human Recombinant Protein
TP315520 20 µg

Morg1 (WDR83) (NM_001099737) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705928 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
SPAST Polyclonal Antibody
E-AB-16442-01 20 µL

SPAST Polyclonal Antibody

Sign In for Pricing
View Details