Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-8 (TVB58), Biotinylated

This Recombinant Human T cell receptor beta variable 5-8 (TVB58), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-8 TRBV5-8 TCRBV5S4A2T

UniProt

A0A5A2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TGF-beta 1/ TGFB1 Protein, Untagged, HO cells.-5ug
QP773-5ug 5ug

Recombinant Human TGF-beta 1/ TGFB1 Protein, Untagged, HO cells.-5ug

Sign In for Pricing
View Details
PCDH21 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2521942 100 µL

PCDH21 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Absolute Mag Amine Iron Oxide Nanoparticles, Cy5, 20 nm
DAG-WT1150-01 1 mL

Absolute Mag Amine Iron Oxide Nanoparticles, Cy5, 20 nm

Sign In for Pricing
View Details
Absolute Mag Amine Iron Oxide Nanoparticles, Cy5, 20 nm
DAG-WT1150-02 1 mg

Absolute Mag Amine Iron Oxide Nanoparticles, Cy5, 20 nm

Sign In for Pricing
View Details
EMID2, ID (EMID2, COL26A1, EMU2, Collagen alpha-1(XXVI) chain, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2) (Biotin)
MBS6295459-01 0.2 mL

EMID2, ID (EMID2, COL26A1, EMU2, Collagen alpha-1(XXVI) chain, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2) (Biotin)

Sign In for Pricing
View Details
EMID2, ID (EMID2, COL26A1, EMU2, Collagen alpha-1(XXVI) chain, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2) (Biotin)
MBS6295459-02 5x 0.2 mL

EMID2, ID (EMID2, COL26A1, EMU2, Collagen alpha-1(XXVI) chain, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2) (Biotin)

Sign In for Pricing
View Details