Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-3 (TVBK3), Biotinylated

This Recombinant Human T cell receptor beta variable 11-3 (TVBK3), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-3 TRBV11-3 TCRBV21S2A2

UniProt

A0A5A6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYLQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LOC134147/CMBL Antibody Picoband®, Cy3 Conjugate
A04921-1-Cy3 100 µg/Vial

Anti-LOC134147/CMBL Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Dividers for 75 mm boxes 136x136, grid 4 x 4, H: 40 mm
TE22709 36 Cases

Dividers for 75 mm boxes 136x136, grid 4 x 4, H: 40 mm

Sign In for Pricing
View Details
S100-A7 Antibody
E38PA4225 100 µL

S100-A7 Antibody

Sign In for Pricing
View Details
Gab1 Rabbit Polyclonal Antibody
orb6061-01 50 μL

Gab1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gab1 Rabbit Polyclonal Antibody
orb6061-02 100 µL

Gab1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gab1 Rabbit Polyclonal Antibody
orb6061-03 200 µL

Gab1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details