Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated

This Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Horseradish Peroxidase,  20nm
GM-503-20 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Horseradish Peroxidase, 20nm

Sign In for Pricing
View Details
IFNAR1 Recombinant Rabbit Monoclonal Antibody [SR45-08]
ET1602-37 100 µL

IFNAR1 Recombinant Rabbit Monoclonal Antibody [SR45-08]

Sign In for Pricing
View Details
1-Hexyl-3-(1-naphthoyl)indoleJWH 19
TRC-H296800-25MG 25 mg

1-Hexyl-3-(1-naphthoyl)indoleJWH 19

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total MK1A6,  10nm
GM-210-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total MK1A6, 10nm

Sign In for Pricing
View Details
OGA Rabbit Monoclonal Antibody [Clone ID: 24GB6120]
TA424981 100 µL

OGA Rabbit Monoclonal Antibody [Clone ID: 24GB6120]

Sign In for Pricing
View Details
Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH
HA710254 100 µg

Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details