Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated

This Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Lactamase (FITC) discontinued
B1083-50-FITC 200 µL

Beta Lactamase (FITC) discontinued

Sign In for Pricing
View Details
Ccnd3 (NM_012766) Rat Tagged Lenti ORF Clone
RR209771L4 10 µg

Ccnd3 (NM_012766) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042222-01 0.02 mg

ATP synthase subunit b

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042222-02 0.1 mg

ATP synthase subunit b

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042222-03 5x 0.1 mg

ATP synthase subunit b

Sign In for Pricing
View Details
Anti-B. anthracis PA (Raxibacumab)-SPDB-DM4 ADC
ADC-W-2037 1 mg

Anti-B. anthracis PA (Raxibacumab)-SPDB-DM4 ADC

Sign In for Pricing
View Details