Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated

This Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-2/delta variable 8 TRAV38-2DV8

UniProt

A0JD32

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 490)
MBS6207063-01 0.1 mL

KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 490)

Sign In for Pricing
View Details
KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 490)
MBS6207063-02 5x 0.1 mL

KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 490)

Sign In for Pricing
View Details
HBQ1 Protein, Human, Recombinant (His)
TMPJ-00812-01 5 µg

HBQ1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
HBQ1 Protein, Human, Recombinant (His)
TMPJ-00812-02 10 µg

HBQ1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
HBQ1 Protein, Human, Recombinant (His)
TMPJ-00812-03 20 µg

HBQ1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
HBQ1 Protein, Human, Recombinant (His)
TMPJ-00812-04 50 µg

HBQ1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details