Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated

This Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 9 Activity Detection Substrate for Flow Cytometry
E-CK-A489-01 20 Tests

Caspase 9 Activity Detection Substrate for Flow Cytometry

Sign In for Pricing
View Details
Caspase 9 Activity Detection Substrate for Flow Cytometry
E-CK-A489-02 100 Tests

Caspase 9 Activity Detection Substrate for Flow Cytometry

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631936 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CELA2A Human Gene Knockout Kit (CRISPR)
KN402746 1 Kit

CELA2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexadecanamide
TRC-H293523-5G 5 g

Hexadecanamide

Sign In for Pricing
View Details
Indo-1, AM Ester
#50044 1x 1 mg

Indo-1, AM Ester

Sign In for Pricing
View Details