Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated

This Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NOTCH2 protein, His-tagged
NOTCH2-3228H 25 µg

Recombinant Human NOTCH2 protein, His-tagged

Sign In for Pricing
View Details
KRT18P33 Protein Vector (Human) (pPM-C-His)
PV089585 500 ng

KRT18P33 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human EPHA8 knockout cell line
ABC-KH4842 1 Vial

Human EPHA8 knockout cell line

Sign In for Pricing
View Details
Phosphatidylcholine:ceramide cholinephosphotransferase 1 (SGMS1) Rat ELISA Kit
F8300 96 Tests

Phosphatidylcholine:ceramide cholinephosphotransferase 1 (SGMS1) Rat ELISA Kit

Sign In for Pricing
View Details
MIR5705 Protein Vector (Human) (pPM-C-His)
PV099645 500 ng

MIR5705 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)
MBS2062715-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)

Sign In for Pricing
View Details