Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNLA), partial, Biotinylated

This Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNLA), partial, Biotinylated spans the amino acid sequence from region 27-254. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative butyrophilin-like protein 10 pseudogene BTNL10P BTNL10

UniProt

A8MVZ5

Expression Region

27-254

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIWKADFDVTGPHAPILAMAGGHVELQCQLFPNISAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTTFDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVERRDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLPATFSRSSQFTAWKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsen2 ORF Vector (Mouse) (pORF)
48551014 1.0 µg DNA

Tsen2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ACO2, ID (Aconitate Hydratase, Mitochondrial, Citrate Hydro-lyase, Aconitase) (Biotin)
MBS6461105-01 0.2 mL

ACO2, ID (Aconitate Hydratase, Mitochondrial, Citrate Hydro-lyase, Aconitase) (Biotin)

Sign In for Pricing
View Details
ACO2, ID (Aconitate Hydratase, Mitochondrial, Citrate Hydro-lyase, Aconitase) (Biotin)
MBS6461105-02 5x 0.2 mL

ACO2, ID (Aconitate Hydratase, Mitochondrial, Citrate Hydro-lyase, Aconitase) (Biotin)

Sign In for Pricing
View Details
Tnfrsf1b-set siRNA/shRNA/RNAi Lentivector (Rat)
47211096 4x 500 ng

Tnfrsf1b-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB8A Antibody
NBP3-35798-100ul 100 µL

Rabbit Polyclonal ZBTB8A Antibody

Sign In for Pricing
View Details
NDUFAB1 Rabbit pAb
E45R21213N 50 ul

NDUFAB1 Rabbit pAb

Sign In for Pricing
View Details