Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HOXB-AS3 peptide (HAS3P), Biotinylated

This Recombinant Human HOXB-AS3 peptide (HAS3P), Biotinylated spans the amino acid sequence from region 1-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HOXB-AS3 peptide HOXB-AS3

UniProt

C0HLZ6

Expression Region

1-53

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc9a3r2 shRNA (UAS) - Lentiviral mouse Slc9a3r2 shRNA (UAS, RFP) (100)
GTR15128856 1 Vial

Lentiviral mouse Slc9a3r2 shRNA (UAS) - Lentiviral mouse Slc9a3r2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ELISA Kit For Glutamate receptor ionotropic, NMDA 2D
E11301h 96 Tests

ELISA Kit For Glutamate receptor ionotropic, NMDA 2D

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)
MBS1195019 Inquire

Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)

Sign In for Pricing
View Details
Interleukin-1 alpha
orb1640652-01 50 µg

Interleukin-1 alpha

Sign In for Pricing
View Details
Interleukin-1 alpha
orb1640652-02 100 µg

Interleukin-1 alpha

Sign In for Pricing
View Details
Interleukin-1 alpha
orb1640652-03 1 mg

Interleukin-1 alpha

Sign In for Pricing
View Details