Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative RNA-binding regulatory peptide (RBRP), Biotinylated

This Recombinant Human Putative RNA-binding regulatory peptide (RBRP), Biotinylated spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1

UniProt

C0HM01

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,6-Dichloropyrene
TRC-D436845-50MG 50 mg

1,6-Dichloropyrene

Sign In for Pricing
View Details
MX1 (NM_002462) Human Over-expression Lysate
LC400886 20 µg

MX1 (NM_002462) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), 0.2mg/mL
BNUB1388-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Mrps16 activation kit by CRISPRa
GA206658 1 Kit

Mouse Mrps16 activation kit by CRISPRa

Sign In for Pricing
View Details
NIPSNAP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]
TA505585AM 100 µL

NIPSNAP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]

Sign In for Pricing
View Details
3-(Perfluorooctyl)propan-1-ol
TRC-P336313-5G 5 g

3-(Perfluorooctyl)propan-1-ol

Sign In for Pricing
View Details