Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative RNA-binding regulatory peptide (RBRP), Biotinylated

This Recombinant Human Putative RNA-binding regulatory peptide (RBRP), Biotinylated spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1

UniProt

C0HM01

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal S100A3 Antibody (001) [DyLight 550]
NBP2-90583R 0.1 mL

Rabbit Monoclonal S100A3 Antibody (001) [DyLight 550]

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) CNOT7 Polyclonal Antibody
MBS7187167 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) CNOT7 Polyclonal Antibody

Sign In for Pricing
View Details
PLAU Antibody
A47579-100UL 100 µL

PLAU Antibody

Sign In for Pricing
View Details
Lano/LRRC1 Rabbit Polyclonal Antibody
orb184850-01 50 μL

Lano/LRRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lano/LRRC1 Rabbit Polyclonal Antibody
orb184850-02 100 µL

Lano/LRRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lano/LRRC1 Rabbit Polyclonal Antibody
orb184850-03 200 µL

Lano/LRRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details