Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS), Biotinylated

This Recombinant Human Protein SHMOOSE (SHMOS), Biotinylated spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSL24D1P7 Protein Vector (Human) (pPM-C-HA)
42786021 500 ng

RSL24D1P7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
4-Hydroxybenzimidamide
TRC-H247365-50MG 50 mg

4-Hydroxybenzimidamide

Sign In for Pricing
View Details
Human Aimp1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) ELISA Kit
FY-EH1531 96 Well

Human Aimp1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) ELISA Kit

Sign In for Pricing
View Details
DDX27 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
17826064 1.0 µg DNA

DDX27 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Monoclonal RARRES1 Antibody (OTI1D2) [DyLight 755]
NBP2-73803IR 0.1 mL

Mouse Monoclonal RARRES1 Antibody (OTI1D2) [DyLight 755]

Sign In for Pricing
View Details
CRX Rabbit pAb
E95719 100 µL

CRX Rabbit pAb

Sign In for Pricing
View Details