Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial, Biotinylated

This Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial, Biotinylated spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative dispanin subfamily A member 2d; DSPA2d

UniProt

C9JQL5

Expression Region

1-57

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E.coli FocA Rabbit Polyclonal Antibody (FITC)
orb2571404 200 µL

E.coli FocA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HIST1H3B, Phosphorylated (T12) (Histone Cluster 1, H3b, H3/l, H3FL) (AP)
MBS6420402-01 0.1 mL

HIST1H3B, Phosphorylated (T12) (Histone Cluster 1, H3b, H3/l, H3FL) (AP)

Sign In for Pricing
View Details
HIST1H3B, Phosphorylated (T12) (Histone Cluster 1, H3b, H3/l, H3FL) (AP)
MBS6420402-02 5x 0.1 mL

HIST1H3B, Phosphorylated (T12) (Histone Cluster 1, H3b, H3/l, H3FL) (AP)

Sign In for Pricing
View Details
Rosbin shRNA (m) Lentiviral Particles
sc-153065-V 200 µL

Rosbin shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Glycerol-3-phosphate acyltransferase (plsY), partial
MBS7081305 Inquire

Recombinant Salmonella choleraesuis Glycerol-3-phosphate acyltransferase (plsY), partial

Sign In for Pricing
View Details
Recombinant Galectin 1 (GAL1)
SIPA301Bo01-01 10 µg

Recombinant Galectin 1 (GAL1)

Sign In for Pricing
View Details