Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase (NDUCR), partial, Biotinylated

This Recombinant Human NADH dehydrogenase (NDUCR), partial, Biotinylated spans the amino acid sequence from region 1-55. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2; NDUFC2-KCTD14 readthrough transcript protein; NDUFC2-KCTD14

UniProt

E9PQ53

Expression Region

1-55

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Anti-Human Phospho-Tau (Thr217) Antibody, Mouse IgM (6G7C8)
PT7-Y2074-100ug 100 µg

Monoclonal Anti-Human Phospho-Tau (Thr217) Antibody, Mouse IgM (6G7C8)

Sign In for Pricing
View Details
CA1 Antibody
8C14934-AAT 50 µg

CA1 Antibody

Sign In for Pricing
View Details
Recombinant Human AMPK (G1/B2/A1) Heterotrimer Protein
PKSH030313 50 µg

Recombinant Human AMPK (G1/B2/A1) Heterotrimer Protein

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF405S conjugate, 0.1mg/mL
BNC042809-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E6]
TA801710AM 100 µL

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E6]

Sign In for Pricing
View Details
(+)-Isolysergic Acid Diethylamide-d10
TRC-I821062-1MG 1 mg

(+)-Isolysergic Acid Diethylamide-d10

Sign In for Pricing
View Details