Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase (NDUCR), partial, Biotinylated

This Recombinant Human NADH dehydrogenase (NDUCR), partial, Biotinylated spans the amino acid sequence from region 1-55. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2; NDUFC2-KCTD14 readthrough transcript protein; NDUFC2-KCTD14

UniProt

E9PQ53

Expression Region

1-55

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF740 conjugate, 0.1mg/mL
BNC741925-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOK5 (NM_018431) Human Over-expression Lysate
LC402687 20 µg

DOK5 (NM_018431) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXP3 (FXP3/197), CF740 conjugate, 0.1mg/mL
BNC740197-100 1x 100 µL

FOXP3 (FXP3/197), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS1-4), CF405S conjugate, 0.1mg/mL
BNC041745-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS1-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CC2D1A (NM_017721) Human Recombinant Protein
TP309105L 1 mg

CC2D1A (NM_017721) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human EphA2 Protein (His Tag)
PKSH032009-01 10 µg

Recombinant Human EphA2 Protein (His Tag)

Sign In for Pricing
View Details